PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_15135.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 286aa    MW: 32909.4 Da    PI: 8.3982
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_15135.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.46.9e-54101351128
                      NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              lppGfrFhPtdeel+++yL+++++++++++ ++i+evd+yk++Pw+Lp+k++ +ekewyfF++rd+ky++g r+nra+ sgyWkat
  Sme2.5_15135.1_g00001.1  10 LPPGFRFHPTDEELIMYYLRNQATSRPCPV-SIIPEVDVYKFDPWELPEKAEFGEKEWYFFTPRDRKYPNGVRPNRAAVSGYWKAT 94 
                              79****************************.89***************99999********************************* PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g+dk+++s +++ vg+kk Lvfykg+ pkg ktdW+mheyrl
  Sme2.5_15135.1_g00001.1  95 GTDKAIYS-GSKYVGIKKALVFYKGKPPKGIKTDWIMHEYRL 135
                              ********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.29E-659162IPR003441NAC domain
PROSITE profilePS5100561.33110162IPR003441NAC domain
PfamPF023651.8E-2611135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009825Biological Processmultidimensional cell growth
GO:0009835Biological Processfruit ripening
GO:0009908Biological Processflower development
GO:0010150Biological Processleaf senescence
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MVGKNSPEHL PPGFRFHPTD EELIMYYLRN QATSRPCPVS IIPEVDVYKF DPWELPEKAE  60
FGEKEWYFFT PRDRKYPNGV RPNRAAVSGY WKATGTDKAI YSGSKYVGIK KALVFYKGKP  120
PKGIKTDWIM HEYRLSESRS PPTRPNGSMR LDDWVLCRIY QKKNLGRAME MIKVEEDTQQ  180
PEIMSSINPG EVVAATGQQT LKLPRTCSLS HLLEMDYFGS ISQLFDDTSY NTISQNNTLL  240
TNVNANVPQD MEKFQLGDVS HQYMIQNNSN TFLKQPIFVN PAFPFQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-731016417167NO APICAL MERISTEM PROTEIN
1ut4_B2e-731016417167NO APICAL MERISTEM PROTEIN
1ut7_A2e-731016417167NO APICAL MERISTEM PROTEIN
1ut7_B2e-731016417167NO APICAL MERISTEM PROTEIN
3swm_A3e-731016420170NAC domain-containing protein 19
3swm_B3e-731016420170NAC domain-containing protein 19
3swm_C3e-731016420170NAC domain-containing protein 19
3swm_D3e-731016420170NAC domain-containing protein 19
3swp_A3e-731016420170NAC domain-containing protein 19
3swp_B3e-731016420170NAC domain-containing protein 19
3swp_C3e-731016420170NAC domain-containing protein 19
3swp_D3e-731016420170NAC domain-containing protein 19
4dul_A2e-731016417167NAC domain-containing protein 19
4dul_B2e-731016417167NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00221DAPTransfer from AT1G69490Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006344264.10.0PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-112NAC29_ARATH; NAC transcription factor 29
TrEMBLM0ZSU10.0M0ZSU1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000073410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.11e-114NAC-like, activated by AP3/PI